FUS2 (NAT6) Rabbit Polyclonal Antibody TA346764 from OriGene Technologies | Biocompare.com

Supplier Images

FUS2 (NAT6) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FUS2 (NAT6) Rabbit Polyclonal Antibody

OriGene Technologies' FUS2 (NAT6) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The FUS2 (NAT6) Rabbit Polyclonal Antibody was generated using N-alpha-acetyltransferase 80, NatH catalytic subunit, and NAA80 as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-NAT6 Antibody

Product Specs
ItemFUS2 (NAT6) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA346764
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetNAA80
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-NAT6 antibody: synthetic peptide directed towards the C terminal of human NAT6. Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP
NCBI Full Gene NameN-alpha-acetyltransferase 80, NatH catalytic subunit
NCBI Gene AliasesFUS-2, FUS2, NAT6, HsNAAA80
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!